DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:203 Identity:44/203 - (21%)
Similarity:78/203 - (38%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLL-ATERSVDKLMDTSIPVPRISWLNENIACCATGNTAD----GNVLVNQLRMI 92
            |.:|...:.||:| |..|:.......|..:.:|..||:.:.....|..||    ..||..:.|: 
  Fly    73 TTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECRL- 136

  Fly    93 AQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSG 157
               :|..:.:.:..:.....:|:|...|...|    ..:..:..|:|.. |.:|...|..|..|.
  Fly   137 ---HQLRYRKRMTVDTAARIICNISTEYKGMG----LVMGMMLAGFDDE-GPKLIYVDSEGMRSH 193

  Fly   158 WKATCIGRKSGAAMEMLQKELFSKGY-VSPSVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRY 221
            .:...:|..|..|:.:|     ..|| ...|.:||.|:|.:.:.....:|:.:.           
  Fly   194 GQVFSVGSGSPYALGVL-----DTGYRYDLSDQEAYDLARRAIYHATSKDAYSG----------- 242

  Fly   222 GNTTVFHI 229
            |...::||
  Fly   243 GIVRLYHI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 44/203 (22%)
Ntn_hydrolase 3..218 CDD:294319 41/190 (22%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 44/203 (22%)
proteasome_beta_type_5 72..259 CDD:239730 44/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.