DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psma8

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:253 Identity:87/253 - (34%)
Similarity:138/253 - (54%) Gaps:13/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            ||..:|...|:|||:|.|:|||||.||..:..|.||:...|.|:|..| :||.||.|.. .|.:|
  Rat     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDER-TVRKI 64

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|::::.....|.|||..|::::.|:..|.::....:.:..|.:...:..:||.|||..|:|||
  Rat    65 CALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPF 129

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            |:|.|.:|:|.....:|||:||||.|..|||..|||.:....|.|:|. :::..:| :..||..:
  Rat   130 GISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKN-YTEDAIS-NDNEAIKL 192

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHI----LEKNEIHRLIERNNNLKRR 248
            |||.:...:....   :.:|:|.::|.....:|..    ||..||.|  |::...|::
  Rat   193 AIKALLEVVQSGG---KNIELAIIRRDQPLKMFSAKEIELEVTEIER--EKDEAEKKK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 85/244 (35%)
Ntn_hydrolase 3..218 CDD:294319 76/215 (35%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 80/234 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 76/213 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.