DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosalpha7

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:240 Identity:75/240 - (31%)
Similarity:120/240 - (50%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVP----RIS 65
            :|...:.|||:||::|::||.:|..:|||.:|:..|:.|:||    |:|::.:.:..|    ||.
  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLA----VEKIITSKLYEPDAGGRIF 68

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
            .:.:||.....|..||||.:.:..|..|..|:..|.:.||.:.|...:.....|||.|...||||
  Fly    69 TIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFG 133

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAA---MEMLQKELFSKGYVSPSVEEAK 192
            :|.:...||...|.|||:.:|||:..|:.|...|:....|   ||.|:.::    .....||.|.
  Fly   134 LSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDM----RTDELVESAG 194

  Fly   193 DVAIKVMGMTLGRDSLTPE--KLEIAFVQRYGNTTVFHILEKNEI 235
            ::..||      .|.|..:  :.|:..|.|.  |...|::..:|:
  Fly   195 EIIYKV------HDELKDKDFRFEMGLVGRV--TGGLHLINPSEL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 75/240 (31%)
Ntn_hydrolase 3..218 CDD:294319 70/221 (32%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 70/221 (32%)
PRE1 6..231 CDD:223711 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.