DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta4

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:200 Identity:39/200 - (19%)
Similarity:75/200 - (37%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLLATE----RSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIA 93
            |.:|:...:.|:||.:    ||:..:.:....:.::|   :::.....|.:.|.......:....
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVS---DSLLISTVGESGDTEQFTEFISKNI 64

  Fly    94 QQYQFNFG-EMIPCEQ---LVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGN 154
            ..|:...| ::.|.|.   ...||.:..::.|      |:.|.....|:|...|.:|...|...|
  Fly    65 ALYKMRNGYDLSPRESAHFTRKNLAEYLRSRT------PYQVFMFVAGYDPNAGPELTFIDYLAN 123

  Fly   155 YSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV--EEAKDVAIKVMGMTLGRDSLTPEKLEIAF 217
              .......|...||   :....::.: |..|::  .||.||..|.:.....|..:..:...:|.
  Fly   124 --ALPVNYAGHGYGA---IFASSIYDR-YWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAV 182

  Fly   218 VQRYG 222
            |.:.|
  Fly   183 VDKDG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 38/199 (19%)
Ntn_hydrolase 3..218 CDD:294319 37/194 (19%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 38/199 (19%)
proteasome_beta_type_2 1..192 CDD:239727 38/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.