DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosalpha6T

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster


Alignment Length:240 Identity:71/240 - (29%)
Similarity:118/240 - (49%) Gaps:16/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLA----TERSVDKLMDTSIPVPRIS 65
            :|:.||.:||:|||:||||||||..|....|||...:..:||    |.:..:.|....:||    
  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMPV---- 66

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
              ::::.....|.|||..|:...:|.....|:.::....|..:||:||.:..|..||...:||:|
  Fly    67 --DDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYG 129

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVA 195
            |..|..|:| ..|..:||..|:.|....||..||.:|.:|...|::.:  :.:....::|....|
  Fly   130 VGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNM--ESFEDCDMDELICHA 191

  Fly   196 IKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIE 240
            |:.:..:||.|.:....:.:|.|   |....|.:..:.|..:.::
  Fly   192 IQAIRGSLGSDDVENLTINVAIV---GKDVPFKMFTEAENQKYVK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 71/240 (30%)
Ntn_hydrolase 3..218 CDD:294319 67/216 (31%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 71/238 (30%)
proteasome_alpha_type_1 6..215 CDD:239718 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.