DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosalpha6

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:255 Identity:83/255 - (32%)
Similarity:124/255 - (48%) Gaps:32/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKN-GVLLATERSVDKLMDTS---IPVPRIS 65
            :||..|::||:|||:||||||||.......|||..|: .||:|..:...:|.||.   ||:    
  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQRKIIPI---- 66

  Fly    66 WLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFG 130
              ::::.....|.|||..||...||.....|:.::....|..:|:|||.:..|..||...:||:|
  Fly    67 --DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYG 129

  Fly   131 VSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVA 195
            |..|..|:|.| |..:||..||..:...||..||.:|.:|...|:|.|      :..::.:||..
  Fly   130 VGLLVAGYDER-GPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNL------NKFLDSSKDEI 187

  Fly   196 IK-----VMGMTLGRDSLTPE----KLEIAFVQRYGNTTVFHILEKNEI--HRLIERNNN 244
            |:     ::| ||..|....:    .:.:|.|   |....|.||...:.  |..|.:.|:
  Fly   188 IRHGIRAILG-TLPTDEQGKDAGQYDITVAIV---GKDQPFTILSNKDSAKHVAIAKEND 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 82/250 (33%)
Ntn_hydrolase 3..218 CDD:294319 75/225 (33%)
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 80/241 (33%)
proteasome_alpha_type_1 6..219 CDD:239718 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.