DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:245 Identity:50/245 - (20%)
Similarity:84/245 - (34%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLNENIA-------CCATGNTADGNVLVNQLR 90
            |.:|:...:.::||::...:|         ...||::.:.       .|......||...:....
  Fly     3 TILGVKGTDFIILASDTMRNK---------SAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSD 58

  Fly    91 MIAQQ---YQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPS 152
            .|.:.   |:...|..:.....|..:.....||.:  ....|.||.|..|:|...|.:|:..|..
  Fly    59 FILRNMDLYKITNGYDLTVRGAVHFIRRHLSAYLK--SDCTFQVSLLVGGYDLTSGPELHYIDYL 121

  Fly   153 GN-----YSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEE----------AKDVAIKVMGMT 202
            ||     |.|         .||||          .:.:|.:||          |.||..|.:...
  Fly   122 GNSVPVRYGG---------HGAAM----------NFCTPILEEFYKPDMDTQAAYDVIKKCVIEL 167

  Fly   203 LGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIERNNNL---KRRV 249
            ..|..:....:::..:.:.|      |.:.|.|:....|.:.|   |||:
  Fly   168 YKRFVINLRNIDLFLISKNG------ITKMNSINLESLRGDILAGPKRRI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 45/232 (19%)
Ntn_hydrolase 3..218 CDD:294319 41/209 (20%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 46/236 (19%)
proteasome_beta_type_2 1..193 CDD:239727 43/225 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.