DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:233 Identity:39/233 - (16%)
Similarity:79/233 - (33%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQY 96
            |.||.:.:.|::|..: |:....:..|..:.::..:|:.|.....|..||.......|....:.:
  Fly    73 TTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLH 137

  Fly    97 QFNFGEMIPCEQLVTNLCDIKQAYTQYG--------GKRPFGVSFLYMGWDCRFGFQLYQSDPSG 153
            :..:.|.:|.:.....:.::...|...|        |..|.|.|.:|:             |.:|
  Fly   138 ELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYV-------------DSNG 189

  Fly   154 NYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFV 218
                              ..:..:||:.|..:|:       |:.::......|....|..::||:
  Fly   190 ------------------LRIHGKLFAVGSGAPN-------ALGILDSDYRLDLSDNEAYDLAFL 229

  Fly   219 QRY----------GNTTVFHILEKN----------EIH 236
            ..|          |...::|:.:.|          |:|
  Fly   230 AVYHATMTDIFSGGVVRLYHMDQGNWRNVANKDCQELH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 39/233 (17%)
Ntn_hydrolase 3..218 CDD:294319 32/193 (17%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 39/233 (17%)
proteasome_beta_type_5 72..259 CDD:239730 37/223 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.