DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:231 Identity:53/231 - (22%)
Similarity:97/231 - (41%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YAMEAASQSGT-CVGLLAKNGVLL-ATERSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVL 85
            |....|.::|| .||::.|:||:| |..|:.:..:.:.....:|..|.::|.||..|..||..::
  Fly    39 YEPPKAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMI 103

  Fly    86 VNQLRMIAQQYQFNFGEMIP--CEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQ 148
            ..........::.|....:|  |..::     :::...:|.|.  .|.:.:..|.|.. |.|||.
  Fly   104 TLTTSAELDLHRLNTERRVPVVCASMM-----LRRTLFRYQGH--IGAALVMGGVDTT-GPQLYC 160

  Fly   149 SDPSGNYSGWKATCIGRKSGAAMEMLQ----------------KELFSKGYVSPSVEEAKDVAIK 197
            ..|.|:........:|..:.|||.:|:                :|..|.| |...:....::.:.
  Fly   161 IYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAG-VFNDLGSGSNIDLC 224

  Fly   198 VM----GMTLGRDSLTPEKLEIAFVQRYG---NTTV 226
            |:    .:.|..|::..||.|  .:.:||   |:|:
  Fly   225 VITAKGAVYLRTDTIASEKGE--RLGKYGIKPNSTM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 53/231 (23%)
Ntn_hydrolase 3..218 CDD:294319 49/218 (22%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 44/201 (22%)
proteasome_beta_type_7 49..236 CDD:239732 42/195 (22%)
Pr_beta_C 241..274 CDD:289249 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.