DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psmb8a

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_571467.3 Gene:psmb8a / 30666 ZFINID:ZDB-GENE-990415-141 Length:271 Species:Danio rerio


Alignment Length:249 Identity:50/249 - (20%)
Similarity:92/249 - (36%) Gaps:61/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EYAMEAASQSGTCVGL------LA---KNGVLLATE--RSVDKLMDTSIPVPRISWLNENIACCA 75
            ::....:.:.|.|:.|      ||   ::||::|.:  .|..|.: .|....::..:|..:....
Zfish    49 KFLKSCSCEDGVCIDLNHGTTTLAFKFRHGVIVAVDSRASAGKYI-ASKEANKVIEINPYLLGTM 112

  Fly    76 TGNTADGNVLVNQLRMIAQQYQFNFGEMI---PCEQLVTNLCDIKQAYTQYGGKRPFGVSF--LY 135
            :|:.||.......|....:.|:....:.|   ...:|::|:         ..|.|..|:|.  :.
Zfish   113 SGSAADCQYWERLLAKECRLYKLRNKQRISVSAASKLLSNM---------MLGYRGMGLSMGSMI 168

  Fly   136 MGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSP------SVEEAKDV 194
            .||| :.|..||..|.:|.          |.||..........::.|.|..      :||||.::
Zfish   169 CGWD-KQGPGLYYVDDNGT----------RLSGRMFSTGCGNSYAYGVVDSGYREDMTVEEAYEL 222

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILE-------KNEIHRLIER 241
            ..:.:.....||:.:.           |...::|:.|       |.::..||.|
Zfish   223 GRRGIAHATHRDAYSG-----------GVVNLYHMQEDGWIKVCKEDVSELIHR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 49/247 (20%)
Ntn_hydrolase 3..218 CDD:294319 43/217 (20%)
psmb8aNP_571467.3 PTZ00488 37..266 CDD:185666 50/249 (20%)
proteasome_beta_type_5 68..255 CDD:239730 43/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.