DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psma6

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_058979.1 Gene:Psma6 / 29673 RGDID:61849 Length:246 Species:Rattus norvegicus


Alignment Length:248 Identity:92/248 - (37%)
Similarity:130/248 - (52%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWL 67
            ||...|||||||||||||||.:|.:|.| |.|.:..|:..::.|::.| |||:|:| .|..:..:
  Rat     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSS-TVTHLFKI 72

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            .|||.|..||.|||....|.:.|..|..:::.:|..||.:.|...:.||.|.|||....||.|..
  Rat    73 TENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCC 137

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197
            .:.:|.|...|.|:|:.||:|.|.|:|||..|.|...:...|:|::..|  ...:.|:..:.||.
  Rat   138 MILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKK--FDWTFEQTVETAIT 200

  Fly   198 VMGMTLGRDSLTPEKLEIAFVQRYGNTTV----FHILEKNEIH----RLIERN 242
            .:...|..| ..|.::|:      |..||    |.||.:.||.    .|.||:
  Rat   201 CLSTVLSID-FKPSEIEV------GVVTVENPKFRILTEAEIDAHLVALAERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 90/245 (37%)
Ntn_hydrolase 3..218 CDD:294319 81/214 (38%)
Psma6NP_058979.1 proteasome_alpha_type_6 8..220 CDD:239723 82/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.