DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psma4

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:243 Identity:137/243 - (56%)
Similarity:182/243 - (74%) Gaps:4/243 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            |:|.:||||||||||||||||||||||...:|||:|:||.:|||||.| |::.||:|......:|
  Rat     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKI 65

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..|||::||...|.|:|.|||.|:||:|||:|...:.|.||||||||.||||||||||:||||||
  Rat    66 YKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF 130

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            |||.||:|||..:|||||||||||||.||||||||..|.||:.||::: :.:|.:  :::.|..:
  Rat   131 GVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQD-YKEGEM--TLKSALAL 192

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIERN 242
            |:||:..|:....|:.||:|||.:.|....||..:|::.|:.:||:::
  Rat   193 AVKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 137/240 (57%)
Ntn_hydrolase 3..218 CDD:294319 129/215 (60%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 129/215 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54118
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003645
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2516
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.