DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb5

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:209 Identity:52/209 - (24%)
Similarity:85/209 - (40%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQ- 95
            |.:....::||::|.: |:.......|..|.::..:|..:.....|..||.:...   |::|:| 
  Rat    61 TTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWE---RLLARQC 122

  Fly    96 --YQFNFGEMI---PCEQLVTNLCDIKQAYTQYGGKRPFGVSF--LYMGWDCRFGFQLYQSDPSG 153
              |:....|.|   ...:|:.|:     .| ||.|   .|:|.  :..|||.| |..||..|..|
  Rat   123 RIYELRNKERISVAAASKLLANM-----VY-QYKG---MGLSMGTMICGWDKR-GPGLYYVDSEG 177

  Fly   154 NYSGWKATCIGRKSGAAMEMLQKELFSKGY-VSPSVEEAKDVAIKVMGMTLGRDSLTPEKLEIAF 217
            |.....|..:|..|..|..::     .:|| ....||||.|:|.:.:.....||:.:.       
  Rat   178 NRISGTAFSVGSGSVYAFGVM-----DRGYSYDLQVEEAYDLARRAIYQATYRDAYSG------- 230

  Fly   218 VQRYGNTTVFHILE 231
                |...::|:.|
  Rat   231 ----GAVNLYHVRE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 52/209 (25%)
Ntn_hydrolase 3..218 CDD:294319 49/194 (25%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 52/209 (25%)
proteasome_beta_type_5 60..247 CDD:239730 52/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.