DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:211 Identity:44/211 - (20%)
Similarity:88/211 - (41%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGLLAKNGVLLATER-SVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIAQQYQF 98
            :|:...:.||:|::| :...::.......::..::|.|.....|...|.......::...|.|:.
Mouse     5 IGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKM 69

  Fly    99 NFG-EMIP---CEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWK 159
            ..| |:.|   ......||.|..::.|      |:.|:.|..|:|...|..||..|.....:  |
Mouse    70 RNGYELSPTAAANFTRRNLADCLRSRT------PYHVNLLLAGYDEHEGPALYYMDYLAALA--K 126

  Fly   160 ATCIGRKSGA--AMEMLQKELFSKGYVSPSVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYG 222
            |.......||  .:.:|.:      |.:|::  :::.|::::...|       |:|:..|:....
Mouse   127 APFAAHGYGAFLTLSILDR------YYTPTI--SRERAVELLRKCL-------EELQKRFILNLP 176

  Fly   223 NTTVFHILEKNEIHRL 238
            ..:| .:::|:.||.|
Mouse   177 TFSV-RVIDKDGIHNL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 44/211 (21%)
Ntn_hydrolase 3..218 CDD:294319 38/189 (20%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 44/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.