DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psma1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:238 Identity:70/238 - (29%)
Similarity:124/238 - (52%) Gaps:11/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAK-NGVLLATERSVDKLMDTSIPVPRISWLN 68
            :|:..|::||:||::|:||||||..|....|||.:| :.||:|.:|:..:|   :....:|..::
Mouse     6 YDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSEL---AAHQKKILHVD 67

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            .:|.....|.|||..:|.|.:|......:|.|...:|..:||:.:....|..||..|:||:||..
Mouse    68 NHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGL 132

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKV 198
            |..|:| ..|..::|:.||.||...:|..||.:|.:|...|::.:  ..::..:::|.....::.
Mouse   133 LIAGYD-DMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHM--SEFMECNLDELVKHGLRA 194

  Fly   199 MGMTL-GRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIE 240
            :..|| ....||.:.:.|..|   |....|.|.:.:::...::
Mouse   195 LRETLPAEQDLTTKNVSIGIV---GKDLEFTIYDDDDVSPFLD 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 70/238 (29%)
Ntn_hydrolase 3..218 CDD:294319 66/214 (31%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 67/218 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.