DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and SPAC6G10.04c

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_594101.1 Gene:SPAC6G10.04c / 2542559 PomBaseID:SPAC6G10.04c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:74/241 - (30%)
Similarity:126/241 - (52%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAK-NGVLLATERSVDKLMDTSIPVPRISWLN 68
            :|...|.:||:|||:|||||:||..|....|||::| :.||:|.:|:.::|......:.||   :
pombe     6 YDGDATTWSPQGRLHQVEYALEAIKQGSATVGLVSKTHAVLVALKRNAEELSSYQKKLIRI---D 67

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            ::|.....|...|..||.|.::..|...:..|...||..:|::.:.:..|..||..|:||:||.|
pombe    68 DHIGIAIAGLAPDARVLSNYMKQEALSSKTLFTRPIPVRRLMSKVAEKAQINTQEYGRRPYGVGF 132

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKV 198
            |.:|:| ..|..|.:..|||....:..|.:|.:|.:|...:::.|.:  :...|.||....|::.
pombe   133 LVIGYD-ESGPHLLEFQPSGLVLEYLGTSMGSRSQSARTYIERNLDT--FPDSSREELILSALRA 194

  Fly   199 MGMTLGRD-SLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIERNN 243
            :..||.:| .||.|.:.|:            ::.|:|.:.|.::|:
pombe   195 LRDTLSKDQELTEENVSIS------------VIGKDEKYTLYDQND 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 73/237 (31%)
Ntn_hydrolase 3..218 CDD:294319 70/214 (33%)
SPAC6G10.04cNP_594101.1 PRE1 4..239 CDD:223711 74/241 (31%)
proteasome_alpha_type_1 6..216 CDD:239718 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.