DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and SPBC646.16

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_595374.1 Gene:SPBC646.16 / 2541139 PomBaseID:SPBC646.16 Length:244 Species:Schizosaccharomyces pombe


Alignment Length:236 Identity:81/236 - (34%)
Similarity:126/236 - (53%) Gaps:8/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ARFFDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSV-DKLMDTSIPVPRI 64
            ||.||...|:|||||||||||||.:|.:.:| |.||:..||...:.:::.| |||:|.| .|..:
pombe     4 ARGFDRTITVFSPEGRLYQVEYAFKAFNNAGITSVGVTGKNCACVISQKKVPDKLIDAS-TVKHV 67

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..:.:.|.|..||:.||....|::.|..|.::::..|..:||:.|...:.:|.|..||....||.
pombe    68 FPITKGIGCVMTGSIADARAQVSRARSEAAEFEYKNGYPMPCDVLAKRMANIAQVSTQRAAMRPL 132

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            ||:...:..|...|..|::.||:|.|.|:|||..|.|....:..|:|. |.|..:..::.:..:.
pombe   133 GVAMTLVAVDDEIGPSLFKLDPAGFYIGYKATSAGPKQTETINWLEKR-FKKDGIPSNLTDTVET 196

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEI 235
            .|:.:..:|..|..:.| |:|..|:   :...|.:|...||
pombe   197 GIQALMSSLSTDFKSTE-LQIGVVE---DDKPFRVLSVEEI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 81/236 (34%)
Ntn_hydrolase 3..218 CDD:294319 75/216 (35%)
SPBC646.16NP_595374.1 PRE1 5..243 CDD:223711 80/235 (34%)
proteasome_alpha_type_6 6..219 CDD:239723 74/215 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.