DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and pre6

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_595165.1 Gene:pre6 / 2540175 PomBaseID:SPBC106.16 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:65/174 - (37%)
Similarity:102/174 - (58%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATER-SVDKLMDTSIPVPRISWLN 68
            :|...::|||:|||.||||..||..:..|.:.|.....:::..|| :|.||.:.| ...:|:.::
pombe     4 YDRALSVFSPDGRLLQVEYGQEAVRRGTTAIALRGNECIVIGVERKNVPKLQNVS-NFQKIAMVD 67

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            .::.....|..||..:|:::.|:.||.::.|..:.:..|.|...:..::|.|||.||.||||||.
pombe    68 NHVCLAFAGLNADARILIDKARVEAQNHKLNLADPVSIEYLTRYVAGVQQKYTQSGGVRPFGVST 132

  Fly   134 LYMGWDCRFGF-QLYQSDPSGNYSGWKATCIGRKSGAAMEMLQK 176
            |..|:|..... ::||::|:|.|:.||||.|||.|.||.|.|:|
pombe   133 LIAGFDVGDNTPRVYQTEPAGIYNAWKATAIGRASKAAREYLEK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 65/174 (37%)
Ntn_hydrolase 3..218 CDD:294319 65/174 (37%)
pre6NP_595165.1 PRK03996 1..232 CDD:235192 65/174 (37%)
proteasome_alpha_type_7 4..211 CDD:239724 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.