DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb7

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:213 Identity:45/213 - (21%)
Similarity:93/213 - (43%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSPEGRLYQVEYAMEAASQSGTCV-GLLAKNGVLL-ATERSVDKLMDTSIPVPRISWLNENIACC 74
            |:.:|      :.:..|.::||.: |::.|:|::| |..|:.:.::.......:|.:::.||.||
Mouse    29 FAKKG------FKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCC 87

  Fly    75 ATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWD 139
            ..|..||.::....:....:.:....|.:   .::||....:||...:|.|.  .|.:.:..|.|
Mouse    88 GAGTAADTDMTTQLISSNLELHSLTTGRL---PRVVTANRMLKQMLFRYQGY--IGAALVLGGVD 147

  Fly   140 CRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV--EEAKDVAIKVMGMT 202
            .. |..||...|.|:........:|..|.|||.:.:.:.      .|.:  ||||.:..:.:...
Mouse   148 VT-GPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKF------RPDMEEEEAKKLVSEAIAAG 205

  Fly   203 LGRDSLTPEKLEIAFVQR 220
            :..|..:...:::..:.:
Mouse   206 IFNDLGSGSNIDLCVISK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 45/213 (21%)
Ntn_hydrolase 3..218 CDD:294319 45/209 (22%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 42/195 (22%)
proteasome_beta_type_7 44..232 CDD:239732 41/192 (21%)
Pr_beta_C 236..271 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.