Sequence 1: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035316.1 | Gene: | Psmb5 / 19173 | MGIID: | 1194513 | Length: | 264 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 51/202 - (25%) |
---|---|---|---|
Similarity: | 80/202 - (39%) | Gaps: | 41/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 NGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTAD----GNVLVNQLRMIAQQYQFNF 100
Fly 101 GEMI---PCEQLVTNLCDIKQAYTQYGGKRPFGVSF--LYMGWDCRFGFQLYQSDPSGNYSGWKA 160
Fly 161 TCIGRKSGAAMEMLQKELFSKGY-VSPSVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNT 224
Fly 225 TVFHILE 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 51/202 (25%) |
Ntn_hydrolase | 3..218 | CDD:294319 | 48/187 (26%) | ||
Psmb5 | NP_035316.1 | proteasome_beta_type_5 | 60..247 | CDD:239730 | 51/202 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |