DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb10

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:180 Identity:48/180 - (26%)
Similarity:84/180 - (46%) Gaps:24/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQSGTCV-GLLAKNGVLL-----ATERSV--DKLMDTSIPVPRISWLNENIACCATGNTADGNV 84
            |.::||.: ||:.::||:|     ||..||  ||..:      :|.::...|.||..|..||..:
Mouse    35 ARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCE------KIHFIAPKIYCCGAGVAADTEM 93

  Fly    85 LVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQS 149
            .........:.:..:.|.. |....||.:  ::|...:|.|.  .|.|.:..|.|.. |.|||:.
Mouse    94 TTRMAASKMELHALSTGRE-PRVATVTRI--LRQTLFRYQGH--VGASLVVGGVDLN-GPQLYEV 152

  Fly   150 DPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKVM 199
            .|.|:||....|.:|...|||:.:|:    .:...:.::|.|:::.::.:
Mouse   153 HPHGSYSRLPFTALGSGQGAAVALLE----DRFQPNMTLEAAQELLVEAI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 48/180 (27%)
Ntn_hydrolase 3..218 CDD:294319 48/180 (27%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 47/176 (27%)
proteasome_beta_type_7 40..226 CDD:239732 46/175 (26%)
Pr_beta_C 232..267 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.