DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb1

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus


Alignment Length:240 Identity:49/240 - (20%)
Similarity:84/240 - (35%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVD--------------KLMDTSIPVP 62
            |||        ||.    ..||.:.:..::..::|::..:.              ||.|.::   
Mouse    29 FSP--------YAF----NGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTV--- 78

  Fly    63 RISWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKR 127
                    |.|  :|...|...|...:....:.|:.:..:.:....:...|..|..:...:    
Mouse    79 --------IGC--SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFF---- 129

  Fly   128 PFGVSFLYMGWDCRFGFQLYQSDPSGNY--SGWKATCIGRKSGAAMEMLQ---------KELFSK 181
            |:.|..:..|.|......:|..||.|:|  ..:||      .|:|..|||         |.:.:.
Mouse   130 PYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKA------GGSASAMLQPLLDNQVGFKNMQNV 188

  Fly   182 GYVSPSVEEA----KDVAIKVMGMTLGRDSLTPEKLEIAFVQRYG 222
            .:|..:::.|    |||.|.    ...||..|.:.|.|..|.:.|
Mouse   189 EHVPLTLDRAMRLVKDVFIS----AAERDVYTGDALRICIVTKEG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 49/240 (20%)
Ntn_hydrolase 3..218 CDD:294319 47/234 (20%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 49/240 (20%)
proteasome_beta_type_1 29..240 CDD:239726 49/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.