DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and pas-2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505750.1 Gene:pas-2 / 179493 WormBaseID:WBGene00003923 Length:231 Species:Caenorhabditis elegans


Alignment Length:232 Identity:90/232 - (38%)
Similarity:125/232 - (53%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLNENIACC 74
            |.|||.|:|.|:|||:.|.......|||.||:||:||||.....|.|..   |::..::::|.|.
 Worm    10 TTFSPSGKLMQIEYALNAVKNGQPSVGLRAKDGVVLATENVGSVLTDDQ---PKVEQISKHIGCV 71

  Fly    75 ATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWD 139
            .:|...|..:||.:.|.||.:|:..:||.:|..||||::..:.|.|||.||.||||.|.|..|||
 Worm    72 YSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTDIAAVMQEYTQSGGVRPFGASLLIAGWD 136

  Fly   140 CRFGFQ-LYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKVMGMTL 203
            ...|.. |:|.||||.|..||||.:|:....|...|:|..      |.::|  .|..|....:||
 Worm   137 KNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRF------SEALE--LDDGIHTALLTL 193

  Fly   204 GRDS----LTPEKLEIAFVQRYGNTTVFHILEKNEIH 236
             |:|    :....:|:|..    |:|.||.|.|.::|
 Worm   194 -RESFDVGMNENNVEVAVC----NSTGFHRLTKQQVH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 90/232 (39%)
Ntn_hydrolase 3..218 CDD:294319 83/212 (39%)
pas-2NP_505750.1 proteasome_alpha_type_2 5..229 CDD:239719 90/232 (39%)
PRK03996 10..228 CDD:235192 90/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.