DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and pas-7

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_496177.2 Gene:pas-7 / 174571 WormBaseID:WBGene00003928 Length:250 Species:Caenorhabditis elegans


Alignment Length:212 Identity:61/212 - (28%)
Similarity:110/212 - (51%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLNE 69
            :|...:.|||:||::|||||.:|...:||.:.:..||||::..::.:...:.|....||:..:|:
 Worm     8 YDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYTDNANPRMFNVND 72

  Fly    70 NIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFL 134
            |:.....||..||..|.|.....|.::..::.|.:|.:.:..::.:....:| .|..||||....
 Worm    73 NVGVAVAGNYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYIHIHT-LGISRPFGAGAF 136

  Fly   135 YMGWDCRFGFQLYQSDPSG-NYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKV 198
            :|.|:.:.|.:|:..:||| ||. :||..:|:...||...::|....:..|:..|:||..:.:.|
 Worm   137 FMSWNKQTGGRLFLVEPSGLNYE-YKAWAVGKHRQAAKAEIEKLKIEELDVNQLVKEAARIIMVV 200

  Fly   199 MGMTLGRDSLTPEKLEI 215
                  ||....:.::|
 Worm   201 ------RDENKDKNVQI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 61/212 (29%)
Ntn_hydrolase 3..218 CDD:294319 61/212 (29%)
pas-7NP_496177.2 proteasome_alpha_type_3 5..216 CDD:239720 61/212 (29%)
PRE1 6..231 CDD:223711 61/212 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.