DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and pbs-5

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:246 Identity:42/246 - (17%)
Similarity:80/246 - (32%) Gaps:95/246 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KNGVLLATE-----------RSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIA 93
            |.|:::|.:           :||.|::|          :.:.:.....|..||            
 Worm    80 KGGIIVAVDSRASSGEYISSKSVMKILD----------IGDRMVATMAGGAAD------------ 122

  Fly    94 QQYQFNFGEMIPCE---QLVTNLCDIKQ----------------AYTQYGGK-RPFGVSFLYMGW 138
                        |:   ::|...|.:.:                |.|.||.: :...|..:..|:
 Worm   123 ------------CQFWTRIVAKYCTLYELREKTSITVSAASKYFANTLYGYRGQGLSVGSMVAGY 175

  Fly   139 DCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV--EEAKDVAIKVMGM 201
            | :.|.|:::.|..|:....|...:|..|..|..:|.      .:..|.:  :||:.:.::.:..
 Worm   176 D-KKGPQIFKVDSEGDRCQLKVCSVGSGSLNAYGILD------NHYKPKMTDDEARKLGLRAIMH 233

  Fly   202 TLGRDS----------LTP-----------EKLEIAFVQRYGNTTVFHILE 231
            ...|||          :||           .||...|....|....::.:|
 Worm   234 ATYRDSGSGGVCNLCHITPTEKIRLPPMDVSKLWYEFADELGRDITYNPVE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 42/246 (17%)
Ntn_hydrolase 3..218 CDD:294319 39/231 (17%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 35/212 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.