Sequence 1: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493558.1 | Gene: | pbs-5 / 173334 | WormBaseID: | WBGene00003951 | Length: | 284 | Species: | Caenorhabditis elegans |
Alignment Length: | 246 | Identity: | 42/246 - (17%) |
---|---|---|---|
Similarity: | 80/246 - (32%) | Gaps: | 95/246 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 KNGVLLATE-----------RSVDKLMDTSIPVPRISWLNENIACCATGNTADGNVLVNQLRMIA 93
Fly 94 QQYQFNFGEMIPCE---QLVTNLCDIKQ----------------AYTQYGGK-RPFGVSFLYMGW 138
Fly 139 DCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSV--EEAKDVAIKVMGM 201
Fly 202 TLGRDS----------LTP-----------EKLEIAFVQRYGNTTVFHILE 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 42/246 (17%) |
Ntn_hydrolase | 3..218 | CDD:294319 | 39/231 (17%) | ||
pbs-5 | NP_493558.1 | Ntn_hydrolase | 65..252 | CDD:320988 | 35/212 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |