DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and pbs-2

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:219 Identity:51/219 - (23%)
Similarity:89/219 - (40%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AMEAASQSGTCVGLLAKNGVLL-----ATERSV--DKLMDTSIPVPRISWLNENIACCATGNTAD 81
            |.:..|...|.|.:..|.|:::     ||..::  ||..:      ::..|.|:|..|..|..||
 Worm    39 APKLTSTGTTIVAVAFKGGLVMGADSRATAGNIIADKHCE------KVHKLTESIYACGAGTAAD 97

  Fly    82 ----GNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRF 142
                ..:|...||::    :.|.|..   .:::|.|...||....|.|   :..::|.:|.....
 Worm    98 LDQVTKMLSGNLRLL----ELNTGRK---ARVITALRQAKQHLFNYQG---YIGAYLLIGGVDPT 152

  Fly   143 GFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKVMGMTLGR-- 205
            |..||....:|....:..|..|..|.||:.:|:::.        .|:..||.|.|::...|..  
 Worm   153 GPHLYMCSANGTTMAFPFTAQGSGSYAAITILERDF--------KVDMTKDEAEKLVQRALEAGM 209

  Fly   206 --DSLTPEKLEIAFVQRYGNTTVF 227
              |:.:...|.:..::  .:.|||
 Worm   210 HGDNASGNSLNLVIIE--PSETVF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 51/219 (23%)
Ntn_hydrolase 3..218 CDD:294319 48/208 (23%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 47/210 (22%)
proteasome_beta_type_7 47..235 CDD:239732 49/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.