DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and pbs-4

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_491261.1 Gene:pbs-4 / 171975 WormBaseID:WBGene00003950 Length:202 Species:Caenorhabditis elegans


Alignment Length:56 Identity:19/56 - (33%)
Similarity:22/56 - (39%) Gaps:10/56 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FGFQLYQSDPSGNYS-GWKAT--CIGRKSGAAM------EMLQKELFSKGY-VSPS 187
            :|..|..|:....|. |.|.|  |||.:...|.      ..||......|| ||||
 Worm    27 YGAILADSENDKEYRLGKKLTMMCIGEEGDVAQFGDWTKRNLQLYSVRNGYEVSPS 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 19/56 (34%)
Ntn_hydrolase 3..218 CDD:294319 19/56 (34%)
pbs-4NP_491261.1 proteasome_beta_type_2 4..199 CDD:239727 19/56 (34%)
PRE1 8..199 CDD:223711 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.