DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and Psmb8

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:237 Identity:52/237 - (21%)
Similarity:88/237 - (37%) Gaps:68/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRISWLNENIACCATGNTA 80
            |..|:|.|     ...|.:....::||::|.: |:......:|:.:.::..:|..:....:|..|
Mouse    63 RNVQIEMA-----HGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAA 122

  Fly    81 DGNVLVNQLRMIAQQYQFNFGEMI---PCEQLVTNLCDIKQAYTQYGGKRPFGVSF--LYMGWDC 140
            |.......|....:.|....||.|   ...:|::|:      ..||.|   .|:|.  :..||| 
Mouse   123 DCQYWERLLAKECRLYYLRNGERISVSAASKLLSNM------MLQYRG---MGLSMGSMICGWD- 177

  Fly   141 RFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFS-------------KGY---VSPSVE 189
            :.|..||..|.:|.          |.||        ::||             .||   :||  |
Mouse   178 KKGPGLYYVDDNGT----------RLSG--------QMFSTGSGNTYAYGVMDSGYRQDLSP--E 222

  Fly   190 EAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILE 231
            ||.|:..:.:.....||:.:.           |...::|:.|
Mouse   223 EAYDLGRRAIAYATHRDNYSG-----------GVVNMYHMKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 52/237 (22%)
Ntn_hydrolase 3..218 CDD:294319 49/222 (22%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 52/237 (22%)
proteasome_beta_type_5 73..260 CDD:239730 48/222 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.