DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AgaP_AGAP001995

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_550819.1 Gene:AgaP_AGAP001995 / 1281126 VectorBaseID:AGAP001995 Length:234 Species:Anopheles gambiae


Alignment Length:236 Identity:79/236 - (33%)
Similarity:116/236 - (49%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWL 67
            |:..|.|| |||.|:|.|:|||:.|.:.....||:.|.|||::|||.....::.....|.::..:
Mosquito     5 RYSFSLTT-FSPSGKLVQIEYALAAVAAGAPSVGIKAVNGVVIATENKQKSILYDEHSVHKVEMV 68

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            ..:|....:|...|..:||.|.|.:||.|...:.|.||..|||..:..:.|.|||.||.||||||
Mosquito    69 TNHIGMIYSGMGPDYRLLVKQARKLAQNYYLTYREPIPTSQLVQKVATVMQEYTQSGGVRPFGVS 133

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197
            .|..|||....: |:|.||||.|..||||.:|:.:......|:|..        |.:...|.|:.
Mosquito   134 LLICGWDDGRPY-LFQCDPSGAYFAWKATAMGKNANNGKTFLEKRY--------SEDLELDDAVH 189

  Fly   198 VMGMTLG---RDSLTPEKLEIAFVQRYGNTTVFHILEKNEI 235
            ...:||.   ...:..:.:|:......|    |..|:.:::
Mosquito   190 TAILTLKEGFEGQMNADNIEVGICDANG----FRRLDPSDV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 79/236 (33%)
Ntn_hydrolase 3..218 CDD:294319 76/217 (35%)
AgaP_AGAP001995XP_550819.1 proteasome_alpha_type_2 6..231 CDD:239719 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.