DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AgaP_AGAP008837

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_319581.3 Gene:AgaP_AGAP008837 / 1279804 VectorBaseID:AGAP008837 Length:207 Species:Anopheles gambiae


Alignment Length:228 Identity:50/228 - (21%)
Similarity:84/228 - (36%) Gaps:72/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCVGLLAKNGVLLATE----RSVDKLMDTSIPVPRISWLNENIACCATGNTAD---------GNV 84
            |.:|:...:.|:||.:    .|:..|.|....:.::|   :|:.....|...|         .|:
Mosquito     5 TLMGIRGPDFVMLAADCTHAHSIMVLKDDEDKILKVS---DNLMLATMGEAGDRVQFTEYISKNI 66

  Fly    85 LVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQS 149
            |:.::|     ..:..|..........||.|..::.|      |:.|:.|..|:|...|.||:  
Mosquito    67 LLYRMR-----NGYELGPKAAAHFTRRNLADYLRSRT------PYHVNLLVGGYDEVDGPQLH-- 118

  Fly   150 DPSGNYSGWKATCIGRKSGA----AM------------EMLQK---ELFSKGYVS---------P 186
                 |..:.|..:..|.||    .|            ::.||   |:|.||...         |
Mosquito   119 -----YIDYLANSLPVKHGAHGYGGMFVNSIFDRYHHDKITQKEAYEIFRKGVTEIHKRLILNLP 178

  Fly   187 SVEEA---KDVAIKVMGMTLGRDSLTPEKLEIA 216
            :.:.|   || .:|.:      |.:||:.|:.|
Mosquito   179 NFKVAVIDKD-GVKYL------DDITPDSLKQA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 50/228 (22%)
Ntn_hydrolase 3..218 CDD:294319 50/228 (22%)
AgaP_AGAP008837XP_319581.3 PRE1 1..196 CDD:223711 46/218 (21%)
proteasome_beta_type_2 3..195 CDD:239727 45/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.