DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AgaP_AGAP010253

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_319444.3 Gene:AgaP_AGAP010253 / 1279677 VectorBaseID:AGAP010253 Length:275 Species:Anopheles gambiae


Alignment Length:249 Identity:81/249 - (32%)
Similarity:134/249 - (53%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKN-GVLLATERSVDKLMDTSIPVPRISWLN 68
            :||..|::||:|||:||||||||.......|||..|: .||:|.:|:..:|   |....:|..::
Mosquito     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKDFAVLIALKRASSEL---SSYQKKIISID 67

  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSF 133
            :::.....|.|||..:|...||.....|::.:....|..:|::||.:..|..||...:||:||..
Mosquito    68 DHLGLSFAGITADARILSRYLRQECLNYKYAYDAFYPVGRLISNLGNKMQVCTQRYDRRPYGVGL 132

  Fly   134 LYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIKV 198
            |.:|:|.: |..:||:.||.|:...||..||.:|.:|...|:|.|.:  :...:.:|.....::.
Mosquito   133 LVIGYDDQ-GPHIYQTCPSANFFDCKAMSIGSRSQSARTYLEKHLAT--FPDCTKDELIRHGVQA 194

  Fly   199 MGMTLGRD-SLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIERNNNLKRRVGS 251
            :..||..: .|..:.:.||.|.:..|   ||:||:.|..:.:   :|:.||.|:
Mosquito   195 LQDTLPNEVELNNKNISIAIVGKGEN---FHVLEEQENDKYL---SNIVRRGGA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 77/237 (32%)
Ntn_hydrolase 3..218 CDD:294319 70/214 (33%)
AgaP_AGAP010253XP_319444.3 PRE1 4..236 CDD:223711 77/241 (32%)
proteasome_alpha_type_1 6..216 CDD:239718 70/215 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.