DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AgaP_AGAP003935

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_318387.2 Gene:AgaP_AGAP003935 / 1278761 VectorBaseID:AGAP003935 Length:246 Species:Anopheles gambiae


Alignment Length:238 Identity:85/238 - (35%)
Similarity:122/238 - (51%) Gaps:16/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSG-TCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWL 67
            ||...|||||||||||||||.:|.:|.| |.:.|..|:..::||::.: |||:|.: .|..:..:
Mosquito     9 FDRHITIFSPEGRLYQVEYAFKAINQEGLTSIALKGKDCAVVATQKKIPDKLIDPA-TVTHLYRI 72

  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132
            ...|.|..||..||....|.:.|..|..:::.:|..||.:.|...:.||.|.|||....||.|.|
Mosquito    73 TREIGCVMTGRIADSRSQVQRARYEAANWRYKYGYEIPVDVLCRRMADISQVYTQNAEMRPLGCS 137

  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197
            .:.:.:|...|..:|::||:|.|.|:.|..:|.|...|...|:|:|..|..:|.  ||...:||.
Mosquito   138 IVMIAFDAENGPAVYKTDPAGYYCGYHAISVGVKQTEANSYLEKKLKRKAELSE--EETIQLAIT 200

  Fly   198 VMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIE 240
            .:...|..| ..|.::||..|.:          ||.|...|.|
Mosquito   201 CLSTVLAVD-FKPTEIEIGIVSK----------EKPEFRTLTE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 85/238 (36%)
Ntn_hydrolase 3..218 CDD:294319 79/214 (37%)
AgaP_AGAP003935XP_318387.2 PRE1 7..245 CDD:223711 85/238 (36%)
proteasome_alpha_type_6 8..220 CDD:239723 79/214 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.