DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AgaP_AGAP004960

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315057.4 Gene:AgaP_AGAP004960 / 1275771 VectorBaseID:AGAP004960 Length:259 Species:Anopheles gambiae


Alignment Length:242 Identity:143/242 - (59%)
Similarity:180/242 - (74%) Gaps:4/242 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATE-RSVDKLMDTSIPVPRI 64
            |||.:||||||||||||||||||||||.|.:||.:|:|||:|:|||.| |:.:||:|..|...:|
Mosquito     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTSLGILAKDGILLAAERRNTNKLLDNVIFSEKI 65

  Fly    65 SWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPF 129
            ..||:::.|...|.|:|.|||.|.||:|||:||.|:||.:||||||::|||:|||||||||||||
Mosquito    66 YKLNDDMVCSVAGITSDANVLTNLLRVIAQRYQLNYGEAMPCEQLVSHLCDVKQAYTQYGGKRPF 130

  Fly   130 GVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDV 194
            |||.||||||..:|:|||||||||||.||||||||..|.||:..|::||.....   |:.:|:|:
Mosquito   131 GVSILYMGWDKHYGYQLYQSDPSGNYGGWKATCIGNNSAAAVSALKQELSDSDI---SLVQAQDL 192

  Fly   195 AIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIER 241
            |:||:..||....||.||:|:|.:.|..|.||..||...|:..||.:
Mosquito   193 AVKVLSKTLDMTKLTSEKIEMAVLTRENNKTVIKILSSAEVDGLIAK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 143/240 (60%)
Ntn_hydrolase 3..218 CDD:294319 132/215 (61%)
AgaP_AGAP004960XP_315057.4 PTZ00246 1..237 CDD:173491 141/238 (59%)
proteasome_alpha_type_4 3..216 CDD:239721 132/215 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54118
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003645
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2516
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.