DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and AgaP_AGAP008816

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_314945.1 Gene:AgaP_AGAP008816 / 1275676 VectorBaseID:AGAP008816 Length:242 Species:Anopheles gambiae


Alignment Length:256 Identity:75/256 - (29%)
Similarity:122/256 - (47%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLNE 69
            :|.....|||||||:|||||:||.....|.:|:...:||::|.|:.:...:.....:.:|..::.
Mosquito     8 YDRGVNTFSPEGRLFQVEYAIEAIKFGSTAIGISTPDGVVMAVEKRITSSLIEPSKMEKIVEVDR 72

  Fly    70 NIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMI---PCEQLVTNLCDIKQAYTQYGG------ 125
            :|.|..:|..||...|:::.|:..|.:.|.:.|.:   .|.|.|:|:.      .|:|.      
Mosquito    73 HIGCATSGLMADSRTLLDRARIECQNHWFVYNERMSVESCAQAVSNVA------IQFGDGDDTDS 131

  Fly   126 --KRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSP-- 186
              .|||||:.|:.|.: ....||:..||||.|..:.|..||..|..|.:.||:      |..|  
Mosquito   132 AMSRPFGVAILFAGIE-NGEPQLWHMDPSGTYIRFDAKAIGSGSEGAQQNLQE------YYLPTM 189

  Fly   187 SVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNT--TVFHILEKNEIHRLIERNNNL 245
            :::||.::|:..:...:      .|||....|:....|  .:|.:..|.|:...|   ||:
Mosquito   190 TIKEAINLALSTLKQVM------EEKLNSTNVEVMTMTPKELFRMFSKEEVEEYI---NNM 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 73/250 (29%)
Ntn_hydrolase 3..218 CDD:294319 67/225 (30%)
AgaP_AGAP008816XP_314945.1 PRK03996 8..240 CDD:235192 73/253 (29%)
proteasome_alpha_type_5 8..220 CDD:239722 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.