Sequence 1: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093250.1 | Gene: | PSMB11 / 122706 | HGNCID: | 31963 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 214 | Identity: | 44/214 - (20%) |
---|---|---|---|
Similarity: | 73/214 - (34%) | Gaps: | 76/214 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 IPVPRISWLNENIACCATGNTAD----GNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQA 119
Fly 120 YTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYV 184
Fly 185 SP--------------SVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKN-- 233
Fly 234 ------------EIHRLIE 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 44/214 (21%) |
Ntn_hydrolase | 3..218 | CDD:294319 | 37/176 (21%) | ||
PSMB11 | NP_001093250.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
proteasome_beta_type_5 | 50..237 | CDD:239730 | 41/196 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 255..300 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |