DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3T and psmb11b

DIOPT Version :9

Sequence 1:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:276 Identity:54/276 - (19%)
Similarity:87/276 - (31%) Gaps:97/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SQSG----------TCVGLLAKNGVLLATERSVDKLMDTSIPV-PRISWLNENIACCATGNTAD- 81
            ||||          |.:|...:.||:.|.:.........:.|. |::..::.::....:|.:|| 
Zfish    97 SQSGALPFTLSHGTTTLGFAFQGGVIAAADTRSSCAGKVACPASPKVLPIHSHLVGTTSGTSADC 161

  Fly    82 ---GNVLVNQLRMIAQQYQFNFGEMIP---CEQLV---------TNLCDIKQAYTQYGGKRPFGV 131
               ..:|..:||:    ||......:.   ..:|:         |.||                |
Zfish   162 ALWKRILARELRL----YQLRHRRRLSTGGAAKLLSHMLHPFKGTELC----------------V 206

  Fly   132 SFLYMGWDCRFGFQLYQSDP--SGNYSGWKATCIGRKSGAAME------------------MLQK 176
            :....|||   |.:...::.  :..|:....|.......||..                  .||.
Zfish   207 AATLCGWD---GDEDQDNEQPMTERYANTTLTSKSSSQSAASSGLSGVRGPRVVYVCSDGLRLQG 268

  Fly   177 ELFSKGYVSP--------------SVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVF 227
            .|||.|..||              |.:||..||.:.:.....||:.:.           .|..::
Zfish   269 ALFSVGSGSPYAYSILDGGVRWGMSAQEAAAVAREAVYRATYRDAYSG-----------NNVDLY 322

  Fly   228 HILEKNEIHRLIERNN 243
            |:..|....|  ||.|
Zfish   323 HVTAKGWRRR--EREN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 51/272 (19%)
Ntn_hydrolase 3..218 CDD:294319 47/249 (19%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 47/258 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.