DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and CG42402

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001287642.1 Gene:CG42402 / 7354470 FlyBaseID:FBgn0259821 Length:747 Species:Drosophila melanogaster


Alignment Length:501 Identity:91/501 - (18%)
Similarity:153/501 - (30%) Gaps:150/501 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALVSPIYSACPKENQMCLR----------------NGTFQYCDGEERN---SSDELMQTHLVYCT 59
            :|:..:..||.|:......                :||..|......:   |:|...:...:...
  Fly   191 SLLQTVVEACQKKKHCKFHGSPEFYGQGSSGVGDSSGTSSYHSSTASSNAISNDPCPKRKKIVEV 255

  Fly    60 SMFCEPEEFQHDYITRNHDQTPHQNKWKRARIGERATLHDVCLLRNGMPVTRECRVKDNRANWES 124
            :..|.|.||:......|.......|.:.|..:...:.                     .|..:||
  Fly   256 AYKCRPYEFRSKVACHNDVAQLECNPYSRIAVYSASF---------------------GRTEYES 299

  Fly   125 TEHWDP-----VVCLRRFREHTISGDLNSLHDDVLEGRRRTNDTQGRREMTGIMRNMFRQRGGNL 184
            .:...|     ..||..:...|:.        .:..||||.|                       
  Fly   300 IQCPQPQGVREETCLASYATETVM--------QICHGRRRCN----------------------- 333

  Fly   185 LPADVHMTGQMFGALMQQDKDATVSVDLVSVCKEIMSCDSKVLRLSAQLNATNSLLSQFESY--- 246
            |.||.:    .||:..|.:....:.|....|.|:::. ::|.|.:.|         .:.|.:   
  Fly   334 LAADAN----TFGSPCQPNSRMYLKVVYTCVPKQVLK-ENKALEVEA---------DESEDFGGD 384

  Fly   247 -MDALPEQLVPKDRCGKVVAKPTSDEAETATTGVETYNFSDIGVQALITGNISVFFANPECDRIT 310
             .|...::|:.|:  .:.:.|..|:    .||.|.......:|:      ..||..||.:....:
  Fly   385 LNDLYDDELIYKE--SEAIPKLYSN----TTTTVRQNGTRSLGL------GFSVNSANNQSITNS 437

  Fly   311 GLAIFSAPGDQRKTSASGFWYRFIRFSEDLAKVKEESNL--ETAAFLPENLWRQVKSRGATYLIF 373
            .|.:   .||:...:.      .:..|.||:..:::..|  ...|.:...:...:...|....:.
  Fly   438 SLVV---EGDRSDVNP------VMTHSADLSLEEDQERLYFYLLALVSLGVLISIVIFGTRIALQ 493

  Fly   374 KVYAHDALFVETSLQRTRKPRSKVISISIPGLRSNYLS-----------LPLPFLLRNENL---- 423
            |.:    |..||......|...:|...:||...::.:|           ||||.|...||.    
  Fly   494 KHH----LVTETLSSSFAKTTRRVEETTIPSGLNDTISEIDAEIDLKTTLPLPNLSNKENYLTYA 554

  Fly   424 ----------RNPDSKAFSIGSGCGYWNYETWSTEGVSTESSSDLL 459
                      ||....|.|.||..|    :......|.|..|.||:
  Fly   555 PTSSLYADLPRNQLVSACSQGSAAG----QIGKPHIVGTRQSPDLI 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 6/23 (26%)
7tm_4 500..750 CDD:304433
CG42402NP_001287642.1 Gal_Lectin <181..259 CDD:280328 9/67 (13%)
Gal_Lectin 277..359 CDD:280328 21/137 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.