DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and mthl7

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:381 Identity:63/381 - (16%)
Similarity:136/381 - (35%) Gaps:109/381 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 LLKDAIIEC-HTNHLTQFAFLVGGSYRANDLGEEILITPINEKVLDIISIVGCSLSLLGILGIF- 520
            :::|...:| ...:::.|.:.:          ||:.|...|:          |.|.:....|.| 
  Fly   136 IIRDEFFDCDEMIYISDFNYFL----------EEVSIQIFNK----------CGLIVWFQDGKFW 180

  Fly   521 LTAALFKSWRSQA------------STKVLLHLCLA--------------MCLQMMLFVFLNTDD 559
            :|..||...:...            |..::.|.|.:              :|..:.:.|:|.   
  Fly   181 VTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLY--- 242

  Fly   560 VSEALVVNGNTVRCVALGAAMQYSILVL--------------FS----------WMLIIAFLQFQ 600
            :.:...|.|..:.|..:...:|..|::|              :|          |:.:|::..::
  Fly   243 IKKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWK 307

  Fly   601 RYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVALI------DPD--SYVPSAAQLSTDTGICYP 657
            ...::..::...|::...|.| |....:.|..:.::      ||.  :::|....:.......:|
  Fly   308 VLTSLNRVDPNYRFLRYNAFV-WSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHP 371

  Fly   658 SGYGLIFGVVLPVTLITVCNLVIFVYVFYSISHSLSQSIHKNEKKM---------VVKQIRLSIM 713
            |.:..|.|..|.::...|....:.......:...:::..::.|.::         .::.:|||| 
  Fly   372 SVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSI- 435

  Fly   714 LFFLLGLTWIFGIFAFMQ--------AGVAFSYLFCITATMQGFVMFIYFVLLDST 761
               ::||||||.:..:..        .|:...|..    :..|.|:|:..||..||
  Fly   436 ---VMGLTWIFNVIPYSARLHIFWEWVGIISEYFH----SAFGIVLFVLLVLKRST 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 2/17 (12%)
7tm_4 500..750 CDD:304433 50/325 (15%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 16/97 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.