DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and mthl2

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_788462.2 Gene:mthl2 / 38636 FlyBaseID:FBgn0035623 Length:518 Species:Drosophila melanogaster


Alignment Length:336 Identity:73/336 - (21%)
Similarity:145/336 - (43%) Gaps:52/336 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 ILITPINEKVLDIISIVGCSLSLL-GILGIFLTAALFKSWRSQASTKVLLHLCLAMCLQM-MLFV 553
            |.|.|.|..:|.  |..|.::.:: .::.:.||.|::...:...:.:....:|..|||.. .||:
  Fly   204 IRIIPHNCLILP--SRTGQTVVMITSLICLVLTIAVYLCVKKLMNLEGKCFICYMMCLFFGYLFL 266

  Fly   554 FLNTDDVSEALVVNGNTVRCVALGAAMQYSILVLFSWMLIIAFLQFQRYVT----VIGIERPPRY 614
            .|:..::|...        |.|.|....:.::..|.|:.||: ..:.:.:|    .:.| |..|.
  Fly   267 LLDLWELSLDF--------CKAAGFLGYFFVMAAFFWLSIIS-RHYWKCLTNPCASMNI-RSERA 321

  Fly   615 ILKAAIVAWLLPLVPTLLVALID----PDSYVPSAAQLSTDTGIC--YPSGYGLIFGVVLPVTLI 673
            .|..:..||.:||..|.:..|.|    .:.:.|...    |.|.|  |...:..:.....|:.|:
  Fly   322 FLLYSCFAWAMPLALTGVTYLADNVVNNEEWQPRVG----DEGHCWIYTKSWSAMVYFYGPMVLL 382

  Fly   674 TVCNLVIFVYVFYSI--SHSLSQSIHKNEKKMVVKQIRLS-------IMLFFLLGLTWIFGIFAF 729
            .:.|:.:||.....|  |....:.|.:||.:  ::::...       ::||.::|::|.|.||::
  Fly   383 ILFNITMFVLTAKHIIDSKRTLRKIARNEGR--IQKLNSDKQNYTQFLLLFTVMGMSWSFEIFSY 445

  Fly   730 M-QAGVAFSYLFCITATM---QGFVMFIYFVLLDSTNRR----LWVGLICPTKMELDVQKRTTEL 786
            : |....:..:|.:....   ||.::|:.|:|     ||    |:...|.|.:.........:.:
  Fly   446 LVQREKLWVNIFLVADYFNWSQGVIIFVLFIL-----RRKTLVLFKKQIFPKQRAFSRSATQSTI 505

  Fly   787 QSMTTSSTNYN 797
            :|::.:..::|
  Fly   506 ESISQTKRHFN 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 59/274 (22%)
mthl2NP_788462.2 Methuselah_N 31..211 CDD:284145 3/6 (50%)
7tm_4 221..>395 CDD:304433 40/187 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.