DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and mthl9

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_612029.1 Gene:mthl9 / 38056 FlyBaseID:FBgn0035131 Length:513 Species:Drosophila melanogaster


Alignment Length:298 Identity:57/298 - (19%)
Similarity:124/298 - (41%) Gaps:58/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 EEILITPIN-EK-----------VLDIISIVGCSLSLLGILGIFLTAALFKSWRSQASTKVLLHL 541
            |:..:||:| |:           :..||:|: .::.:|.:||....|      |.....:::::.
  Fly   190 EQWELTPLNCERFQTGYRVWIYAICSIIAII-INIFILSLLGSVRDA------RKSHYGQLIIYY 247

  Fly   542 CLAMCLQMMLFVFL---NTDDVSEALVVNGNTVRCVALGAAMQYSILVLFSWMLIIA---FLQFQ 600
            .|:|.:...|.|:|   |...:|.        |.|..:|....:.|::.|.::.|.:   .|:|:
  Fly   248 LLSMIVGYSLLVYLALKNPMKLSH--------VACRNIGFLAYFCIMLSFVFLAICSLDFLLKFK 304

  Fly   601 RYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVALIDPDSYVPSAAQLSTDTGICY--PSGYGLI 663
            :......:.|     |..|:.  :|.::....:..:..||.:|...:.......|:  ...:|::
  Fly   305 QKAVRSSVRR-----LSLALA--VLAVIGLRFLVSLAQDSKLPKHFKPGMGEDYCWFDVRTWGIL 362

  Fly   664 FGVVLPVTLITVCNLVIFVYVFYSISHSL---SQSIHKNEKKMVVKQIRLSIMLFFLLGL--TWI 723
            .....|:.|:.:.::|..:..::|| :.|   :|.|...:.|:|  :........:::|:  .||
  Fly   363 IYYYGPIALLLIFSIVCCLKAYFSI-YELPPDTQYILGTQLKIV--KTHFYAFSAYIVGVFAVWI 424

  Fly   724 FGIFAFMQAGVAFSYL-------FCITA-TMQGFVMFI 753
            ..|..::.|.|...:.       .||.. .:.||::.:
  Fly   425 REIVVYIMARVREHFFIIDFWSGICILGLAIAGFILLL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 51/270 (19%)
mthl9NP_612029.1 Methuselah_N 29..199 CDD:284145 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.