DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and mthl8

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:317 Identity:61/317 - (19%)
Similarity:113/317 - (35%) Gaps:82/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 SYRANDLGEEILITPI---------------NEKVLDIISIVGCSLS---LLGILGIFLTAALF- 526
            |:|.:...:....||:               .||:..::.:...:.:   |:.||.:|:...:: 
  Fly   173 SHRGHIFSKHYCFTPLLHGNSTWEWQPLACAPEKLYFVLGVREWTYAICLLIAILSMFIVLMVYL 237

  Fly   527 --KSWRSQASTKVLLHLCLAMCLQMMLFVFLNTDDVSEALVVNGNTVRCVALGAAMQYSILVLFS 589
              ...|:......:....:.|.|...|..:|...:.:     |.:...|..|.:....::::.| 
  Fly   238 MCSEMRNSFYGVAIKAYAICMILGYALLAYLTLHNPA-----NLSNAACRILPSLALMNLVLSF- 296

  Fly   590 WMLIIAFLQFQRYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVAL----IDPDSYVPSAAQLST 650
              .|::|:.|:.|::..|       ::...::.||: ..|.:|||:    ....||..|......
  Fly   297 --YILSFIAFKLYLSFYG-------VVFTKLMFWLI-FTPIVLVAVGWSFFVGFSYYGSRLIFGG 351

  Fly   651 DTGICY--PSGYGLIFGVVLPVTLITVCNLVIFVYVFYSI---------SHSLSQSIHKNEKKMV 704
            ||  |:  |..:.::.....||  ...|.:..|.||...|         :....:||.||..|..
  Fly   352 DT--CWFDPRNWSVMIYFYAPV--FVACAISGFFYVLSQIYIRDQPDIETEKSFESIEKNRFKSF 412

  Fly   705 VKQIRLSIMLFFLLGLTWIFGIFAFMQAGVAFSYL------------FCITATMQGF 749
            .|       .|....:.|:..|.:|     ||:|.            ||:  ...||
  Fly   413 WK-------YFGYTAVVWVVCICSF-----AFNYYWENRSHLNYAVSFCM--AFHGF 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 55/283 (19%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.