DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and mthl14

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_728509.1 Gene:mthl14 / 318046 FlyBaseID:FBgn0052476 Length:533 Species:Drosophila melanogaster


Alignment Length:332 Identity:70/332 - (21%)
Similarity:107/332 - (32%) Gaps:133/332 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 LCLAMCLQMMLFVFLNTDDVSEAL----VVNGNTVRCVA----------LGAAMQYSILVLFSWM 591
            |.|...|.|.|.:..|...:|.:|    :.:|..|..|.          :|..:|:.||..|.|.
  Fly   257 LLLVSYLHMTLRLLRNLHGLSLSLMSLCLASGYFVHSVVHIYGIPNQGFIGYVIQFCILSYFFWY 321

  Fly   592 LIIAF----------------------LQFQRYVTVIGIERPPRYILKAAIVAWL----LPLVPT 630
            |.|.|                      ..|..| .|.....|      |.|||..    ||.:|:
  Fly   322 LCICFNVLLNVWYKLPCCIQCSKSWATFNFACY-AVFAFSGP------ATIVALTVQKGLPGMPS 379

  Fly   631 -----LLVALIDPDSY-VPSAAQLSTDTGICYPSGYGLIFGVVLPVTLIT----VCNLVIFVYVF 685
                 |..::.|...| :|                         ||:.|.    :.|::.| :.|
  Fly   380 YFLQGLTESIRDSQRYFIP-------------------------PVSTILFLSFLLNIISF-FGF 418

  Fly   686 YSISHSLSQSIHKNEKKM---------VVKQIRLSIMLFFLLGLTWIFGIFAFMQAGVAFSYLFC 741
            ..||.......:..|:|.         |.|..:...:|..::.::|:..|..| .:|...:||  
  Fly   419 QRISGYAKAEKNIQERKCLFDQQKYEDVKKDAKCVSLLGIIMVVSWLLEIITF-YSGSNSNYL-- 480

  Fly   742 ITATMQGFVMFIYFVLLDSTN--RRLWVGLICPTKMELDVQKRT-----------------TELQ 787
                          :|.|..|  :.:||.||.     |.|::|.                 ||||
  Fly   481 --------------ILCDMVNGLQGVWVLLIF-----LVVRRRRTIILRWWYDRGSHEIEGTELQ 526

  Fly   788 SMTTSST 794
            :::.|.|
  Fly   527 ALSNSPT 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 54/267 (20%)
mthl14NP_728509.1 7tmB3_Methuselah-like 239..512 CDD:320167 64/309 (21%)
TM helix 1 241..266 CDD:320167 3/8 (38%)
TM helix 2 275..297 CDD:320167 5/21 (24%)
TM helix 3 306..331 CDD:320167 9/24 (38%)
TM helix 4 349..369 CDD:320167 8/26 (31%)
TM helix 5 389..418 CDD:320167 8/54 (15%)
TM helix 6 445..472 CDD:320167 6/27 (22%)
TM helix 7 477..502 CDD:320167 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.