DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and ADGRE2

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:XP_011526250.1 Gene:ADGRE2 / 30817 HGNCID:3337 Length:837 Species:Homo sapiens


Alignment Length:467 Identity:123/467 - (26%)
Similarity:189/467 - (40%) Gaps:107/467 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 QRTRKPRSKVIS-ISIPGLRSNYLSLPL----------------------PFLLRN--------- 420
            |::..|...|:. :||||:.......||                      |.||.:         
Human   392 QKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNN 456

  Fly   421 --ENLRNPDSKAFSIGS-----------------GCGYWNYETWSTEGVSTESSSDLLKDAIIEC 466
              :||.:|.:..||..|                 |||:     |:|.|.||..:    :|....|
Human   457 DTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGH-----WATTGCSTIGT----RDTSTIC 512

  Fly   467 HTNHLTQFAFLVGGSYRANDLGEEILITPINEKVLDIISIVGCSLSLLGILGIFLTAALFKSWRS 531
            ...||:.||.|: ..|   |:.||       :.||.:|:.:|.|:|||.:|   |.|..|...::
Human   513 RCTHLSSFAVLM-AHY---DVQEE-------DPVLTVITYMGLSVSLLCLL---LAALTFLLCKA 563

  Fly   532 QASTKVLLHLCLAMCLQMMLFVFLNTDDVSEALVVNGNTVRCVALGAAMQYSILVLFSWMLIIAF 596
            ..:|...|||.|::||.:...:||      .|:...|:.|.|..:...:.|..|...:|||:.|.
Human   564 IQNTSTSLHLQLSLCLFLAHLLFL------VAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL 622

  Fly   597 LQF--QRYVTVIGIERPPRYILKAAI-VAWLLPLVPTLLVALIDPDSY-VPSAAQLSTDTGICYP 657
            ..|  .|.:||:......|::.|... |.:.:|.|...:.|...|..| .||...|..:.     
Human   623 YLFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEK----- 682

  Fly   658 SGYGLIFGVVLPVTLITVCNLVIFVYVFYSISHSLSQ-----SIHKNEKKMVVKQIRLSIMLFFL 717
               |.|:|.:.||..|...|||:|:...:.:.:.||.     |..:|.:.:..|    :....|:
Human   683 ---GFIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFK----ATAQLFI 740

  Fly   718 LGLTWIFGIFAFMQAGVAFSYLFCITATMQGFVMFIYFVLLDSTNRRLWVGLICPTKMELDVQKR 782
            ||.||..||.....|....:|||.|..::||..:|:.:.||....|..:      .|....::|.
Human   741 LGCTWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQVREQY------GKWSKGIRKL 799

  Fly   783 TTELQSMTTSST 794
            .||.:..|.||:
Human   800 KTESEMHTLSSS 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 11/37 (30%)
7tm_4 500..750 CDD:304433 75/258 (29%)
ADGRE2XP_011526250.1 EGF_CA 67..117 CDD:284955
EGF_CA 119..154 CDD:238011
EGF_CA 163..210 CDD:284955
EGF_CA 212..246 CDD:284955
GPS 479..529 CDD:197639 16/62 (26%)
7tm_4 533..774 CDD:304433 75/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.