DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and Adgrg5

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:XP_008770523.1 Gene:Adgrg5 / 307645 RGDID:1305559 Length:564 Species:Rattus norvegicus


Alignment Length:372 Identity:88/372 - (23%)
Similarity:142/372 - (38%) Gaps:81/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 MDALPEQLVPKDRCGKVVAKPTSD--------EAETATTGVETYNFSDIGVQALITGNISVFFAN 303
            ::.|||.|....|..:.:.:..|.        |..........:|.:      |.|.:|......
  Rat    21 VETLPEILNLMKRLERPIGRALSSRVRFIHHLEQMLLNASFHGHNLT------LQTNSIQSLVFK 79

  Fly   304 PECDRITGLAIFSAPGDQRKTSASGFWY-RFIRFSEDLAKVKEESNLETAAFLPENLWRQVKSRG 367
            ..|. ..||::.||    ..|:.|..|. ..::|..:|.|        .|.         |.||.
  Rat    80 LSCG-FPGLSLSSA----TLTNVSQAWAPHAMQFPAELTK--------NAC---------VTSRP 122

  Fly   368 ATYLIFKVYAHDALFVETSLQRTRKPRSKVISISIPGLRSNYLSLPLPFLLRNENL---RNPDSK 429
            |...:..||    .|.....|..|  .|.:::..:.|.:.::  .|:..|.|..|:   .|...:
  Rat   123 AELRLICVY----FFTAHLFQDDR--NSSLLNNYVLGAQLDH--RPVNNLQRPVNISFWHNRSLE 179

  Fly   430 AFSIGSGCGYW-------NYETWSTEGVSTESSSDLLKDAIIECHTNHLTQFAFLVGGSYRANDL 487
            .:::  .|.:|       ::..||.:|..||..|    ...:.||.||||.||.|:..|      
  Rat   180 GYTV--TCVFWKEGAGKHSWGAWSPKGCYTEQPS----PTQVLCHCNHLTYFAVLMQLS------ 232

  Fly   488 GEEI---LITPINEKVLDIISIVGCSLSLLGILGIFLTAALFKSWRSQASTKVLLHLCLAMCLQM 549
            |:.:   |.||     |:.||:||||:|::..|   ||..|....|..:.:...:||.|...:.:
  Rat   233 GDPVPTELQTP-----LEYISLVGCSISIVASL---LTILLNAHSRKLSDSTTRIHLNLNGSVLL 289

  Fly   550 MLFVFLNTDDVSEALVVNGNTVRCVALGAAMQYSILVLFSWMLIIAF 596
            :...||.:..:....|...   .|..|.|.:.|::|...:||.:..|
  Rat   290 LNITFLLSSQMVPPTVPRS---VCTVLAATLHYALLSSLTWMGVEGF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 14/44 (32%)
7tm_4 500..750 CDD:304433 27/97 (28%)
Adgrg5XP_008770523.1 GPS 184..228 CDD:396408 16/47 (34%)
7tm_GPCRs 243..>349 CDD:421689 28/102 (27%)
TM helix 1 243..268 CDD:410628 13/32 (41%)
TM helix 2 277..299 CDD:410628 5/21 (24%)
TM helix 3 311..338 CDD:410628 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6879
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12011
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.