DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and Adgrg3

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:XP_038954076.1 Gene:Adgrg3 / 291854 RGDID:1305674 Length:574 Species:Rattus norvegicus


Alignment Length:421 Identity:94/421 - (22%)
Similarity:175/421 - (41%) Gaps:90/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 SKVISISIPGLRSNYLSLPLPFLLRNENLRNPDSKAFSIGSGCGYWNYE--TWSTEGVSTESSSD 457
            ::::.:|:..:.:..||.|:.....::: ::|     ::...|.:|:..  .|.:.|.|||..  
  Rat   209 NRMVGLSVGQMHATGLSEPVEITFSHQH-QSP-----NVILTCVFWDMAKGDWDSHGCSTEPG-- 265

  Fly   458 LLKDAIIECHTNHLTQFAFLVGGSYRANDLGEEILITPINEKVLDIISIVGCSLSLLGILGIFL- 521
               |....|..:|||.||.|:..:           :.....:.|..||..|.::|:     ||| 
  Rat   266 ---DGRTVCRCDHLTFFALLLRPT-----------LDQATARTLTRISQAGSAVSM-----IFLA 311

  Fly   522 -TAALFKSWR-------SQASTKVLLHLCLAMCLQMMLFVFL-NTDDVSEALVVNGNTVRCVALG 577
             |..|:.::|       |:.:.|:  |:.|:..|.::...|| |....|:     |....|....
  Rat   312 FTMVLYVAFRFSLQRFKSEDAPKI--HMALSTSLFLLNLTFLINVGSGSQ-----GPPASCWVRA 369

  Fly   578 AAMQYSILVLFSWMLIIAFLQFQRYVTVIGIERP--PRYILKAAIVAWLLPLVPTLLVALIDPDS 640
            |...|.:|.:|:||.:.|   |..|:.||.:...  ..|.||.:::.|.||::  :::.:...:|
  Rat   370 AIFHYFLLCVFTWMGLEA---FHLYLLVIKVFNTYFGHYFLKLSLLGWGLPVL--IVIGVGSSNS 429

  Fly   641 ---YVPSAAQLSTDTGICY----PSGYGLIFGVVLPVTLITVCNLVIFVYVFYSISHSLSQSIHK 698
               |.....:..|...:|:    |:.|..:.|..|...|.....|.:..:..:::....:.....
  Rat   430 YGVYTIRDQENRTSLELCWFQKEPALYATVHGYFLVTFLFGAVVLAMVAWKIFTLPSVTAGKGQG 494

  Fly   699 NEKKMVVKQIRLSIMLFFLLGLTWIFGIFAFMQAGVAFSYLFCITATMQGFVMFIYFVLLDSTNR 763
            ...|.|:..:.||    .|:|:||  |:......|::..|:|.:..::||..:|.:|::      
  Rat   495 QTWKSVLTVLGLS----SLVGMTW--GLAVLTPLGLSTVYIFTLLNSLQGLFIFCWFII------ 547

  Fly   764 RLWVGLICPTKMELDVQKRTTELQSMTTSST 794
                 |..||             ||.||||:
  Rat   548 -----LYFPT-------------QSTTTSSS 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 12/39 (31%)
7tm_4 500..750 CDD:304433 63/268 (24%)
Adgrg3XP_038954076.1 GPS 244..282 CDD:396408 14/42 (33%)
7tm_GPCRs 292..551 CDD:421689 66/292 (23%)
TM helix 1 294..319 CDD:410628 10/29 (34%)
TM helix 2 333..355 CDD:410628 7/23 (30%)
TM helix 3 366..393 CDD:410628 9/29 (31%)
TM helix 4 406..426 CDD:410628 5/21 (24%)
TM helix 5 454..481 CDD:410628 5/26 (19%)
TM helix 6 495..522 CDD:410628 9/32 (28%)
TM helix 7 524..549 CDD:410628 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6879
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12011
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.