DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and ADGRF1

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_722582.2 Gene:ADGRF1 / 266977 HGNCID:18990 Length:910 Species:Homo sapiens


Alignment Length:625 Identity:129/625 - (20%)
Similarity:236/625 - (37%) Gaps:133/625 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GNLLPADVHMTGQMFGALMQQDKDATVS--VDLVSVCKEIMSCDSKVLRLSAQLNATNSLLSQFE 244
            ||...|.|....|....:::|:...||.  ..:||:...|.|     |.|::....:||.:....
Human   316 GNATEAAVSSFVQNLSVIIRQNPSTTVGNLASVVSILSNISS-----LSLASHFRVSNSTMEDVI 375

  Fly   245 SYMDALPEQLVPKDRCGKVVAKPTS------DEAETATTGVETY-NFSDIGVQALITGNISVFFA 302
            |..|.:...           |..|:      :|...::..:||. |.|.:.....:..|.|..|.
Human   376 SIADNILNS-----------ASVTNWTVLLREEKYASSRLLETLENISTLVPPTALPLNFSRKFI 429

  Fly   303 NPECDRITGLAIFSAPGDQRKTSASGFWY---------------RFIRFSEDLAKVKEESNLETA 352
            :.:     |:.:      .:.....|:.|               |.:..|:...:...|:.:..|
Human   430 DWK-----GIPV------NKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETIISMA 483

  Fly   353 AFLPENLWRQVKSRGATYLIFKVYAHDALFVETSLQRTRKPRSKVISISIPGLRSNYLSLPLPFL 417
            :....|:....|:..|                       :....|||..|.....|.:.|   |.
Human   484 SLTLGNILPVSKNGNA-----------------------QVNGPVISTVIQNYSINEVFL---FF 522

  Fly   418 LRNE-NLRNPDSKAFSIGSGCGYWNYE--TWSTEGVSTESSSDLLKDAIIECHTNHLTQFAFLVG 479
            .:.| ||..|.         |.:|::.  .|:..|....:.:    ..|:.|...|||.|:    
Human   523 SKIESNLSQPH---------CVFWDFSHLQWNDAGCHLVNET----QDIVTCQCTHLTSFS---- 570

  Fly   480 GSYRANDLGEEILITPINEK----VLDIISIVGCSLSLLGILGIFLTAALF-----KSWRSQAST 535
                       ||::|....    |:..|:.||..:|:..::...:..|||     ||..|....
Human   571 -----------ILMSPFVPSTIFPVVKWITYVGLGISIGSLILCLIIEALFWKQIKKSQTSHTRR 624

  Fly   536 KVLLHLCLAMCLQMMLFVFLNTDDVSEALVVNGNTVRCVALGAAMQYSILVLFSWMLIIAFLQFQ 600
            ..::::.|::.:..:.|:...|.|.:    ||.:.| |.|......:..|.||.|||::..|...
Human   625 ICMVNIALSLLIADVWFIVGATVDTT----VNPSGV-CTAAVFFTHFFYLSLFFWMLMLGILLAY 684

  Fly   601 RYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVALIDPDSYVPSAAQLSTDTGIC---YPSGYGL 662
            |.:.|  .....::::.|  |.:.|.....|::::|......||......|  :|   :.:|...
Human   685 RIILV--FHHMAQHLMMA--VGFCLGYGCPLIISVITIAVTQPSNTYKRKD--VCWLNWSNGSKP 743

  Fly   663 IFGVVLPVTLITVCNLVIFVYVFYSI-SHSLSQSIHKNEKKMVVKQIRLSIMLFFLLGLTWIFGI 726
            :...|:|...|...|.|:.:.|...: ..::.:.:.:::|..:::..:..::|..||||||.|||
Human   744 LLAFVVPALAIVAVNFVVVLLVLTKLWRPTVGERLSRDDKATIIRVGKSLLILTPLLGLTWGFGI 808

  Fly   727 FAFMQA-GVAFSYLFCITATMQGFVMFIYFVLLDSTNRRL 765
            ...:.: .:|:..:|.:....|||.:..:.:||||..|:|
Human   809 GTIVDSQNLAWHVIFALLNAFQGFFILCFGILLDSKLRQL 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 9/39 (23%)
7tm_4 500..750 CDD:304433 60/259 (23%)
ADGRF1NP_722582.2 SEA 154..>215 CDD:279699
GPS 532..572 CDD:280071 11/67 (16%)
7tm_4 582..834 CDD:304433 61/262 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.