DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and mthl12

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster


Alignment Length:336 Identity:65/336 - (19%)
Similarity:130/336 - (38%) Gaps:54/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 LLKDAIIECHTNHLTQFAFLVGGSYRA-----NDLGEEILITPINEKVLDIISIVGCSLSLLGIL 517
            :|||..|..||:    ...|....|..     :|..|.|.|  ||.:....:......||::.::
  Fly   168 ILKDGSILLHTS----AEILSNDQYCLYPEIYSDFPETIRI--INRRC
YRNVMPGIAQLSVISVV 226

  Fly   518 GIFLTAALFKSWRSQASTKVLLHLCLAMCL-QMMLFVFLNTDDVSEALVVNGNTVRCVALGAAMQ 581
            |..||.|::   .|....:.||..||...| .|.:..|:.|.|....|    .:: |.|.|....
  Fly   227 GFILTLAVY---LSVEKLRNLLGKCLICSLFSMFMEYFIWTMDYFRLL----QSI-CSAAGYMKY 283

  Fly   582 YSILVLFSWMLIIAFLQFQRYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVALI------DP-- 638
            :..:..:.|..:::|..::.:.::...|...|:::....| |....:||:::..:      ||  
  Fly   284 FFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFV-WCTAAIPTVVIFSMNQMWENDPGK 347

  Fly   639 DSYVPSAAQLSTDTGICYPSGYGLIFGVVLPVTLITVCNLVIFV----YVFYSISHSLSQSIHKN 699
            ..::|..............|.:   |...:|:.::...|:::||    |: :.:...:......:
  Fly   348 SEWLPLVGYFGCSVKDWNSSSW---FYSHIPIVILNSFNVIMFVLTAIYI-WKVKKGVKSFAQHD 408

  Fly   700 EKKMVVKQIRLS-----IMLFFLLGLTWIFGIFAFMQAGVAFSYLFCITATMQ---------GFV 750
            |:.....:..:.     :.||.::|.:|:......:...   |:|...|..:.         |.:
  Fly   409 ERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAED---SHLLLDTIVLNLTVYLNAAFGIL 470

  Fly   751 MFIYFVLLDST 761
            :|:..:|..||
  Fly   471 IFVLLILKGST 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 6/16 (38%)
7tm_4 500..750 CDD:304433 47/276 (17%)
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.