DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and ADGRF3

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001138640.1 Gene:ADGRF3 / 165082 HGNCID:18989 Length:1079 Species:Homo sapiens


Alignment Length:588 Identity:121/588 - (20%)
Similarity:207/588 - (35%) Gaps:166/588 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PGDQRKTSASGFWYRFIRFSEDLAKVKEESNLETAAFLPEN---------------LWRQVKSR- 366
            ||...:.|:.......:...:.:|||..|:.::......:|               ||...::| 
Human   512 PGQAAEASSPSDLLTLLSTMKYVAKVVAEARIQLDRRALKNLLIATDKVLDMDTRSLWTLAQARK 576

  Fly   367 ---GATYLIFKVYAHDALFVETSLQRTRKPRSKVISISIPGL-----------RSNY-LSLP--- 413
               |:|.|         |.||| |..:..|:....:.|:|.:           .::| :|.|   
Human   577 PWAGSTLL---------LAVET-LACSLCPQDHPFAFSLPNVLLQSQLFGPTFPADYSISFPTRP 631

  Fly   414 ----------LPFLLRNEN--------LRNPD------------------------------SKA 430
                      |..|:||..        ||..|                              .:|
Human   632 PLQAQIPRHSLAPLVRNGTEISITSLVLRKLDHLLPSNYGQGLGDSLYATPGLVLVISIMAGDRA 696

  Fly   431 FSIGS------------GCGYWNYET------WSTEGVSTESSSDLLKDAIIECHTNHLTQFAFL 477
            ||.|.            .|.:|::..      ||.||...:.:|   .....:|...|||.|:.|
Human   697 FSQGEVIMDFGNTDGSPHCVFWDHSLFQGRGGWSKEGCQAQVAS---ASPTAQCLCQHLTAFSVL 758

  Fly   478 VGGSYRANDLGEEILITPINEKVLDIISIVGCSLSLLGI---LGIFLTAALFKSWRSQASTKV-- 537
            :...            |...|..|.:::.||...|:|.:   ||::     :..||.....|:  
Human   759 MSPH------------TVPEEPALALLTQVGLGASILALLVCLGVY-----WLVWRVVVRNKISY 806

  Fly   538 LLHLCLAMCLQMMLFVFLNTDDV---SEALVVNGNTVRCVALGAAMQYSILVLFSWMLIIAFLQF 599
            ..|..|.    .|:|..|..|..   :..|.....:..|:|......:..|..|.|||..|.:..
Human   807 FRHAALL----NMVFCLLAADTCFLGAPFLSPGPRSPLCLAAAFLCHFLYLATFFWMLAQALVLA 867

  Fly   600 QRYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVALIDPDSYVPSAAQLSTDTGICYPSGY-GLI 663
            .:.:.|.......|.:....::.:|.||.    :|.:....|:|....|.  .|.|:..|. |.:
Human   868 HQLLFVFHQLAKHRVLPLMVLLGYLCPLG----LAGVTLGLYLPQGQYLR--EGECWLDGKGGAL 926

  Fly   664 FGVVLPV-TLITVCNLVIFVYVFYSISHSLSQSIHKNEKKMVVKQIRLSIMLFFLLGLTWIFGIF 727
            :..|.|| .:|.|..||:.:.:...:..|||:.....:::.::..|:..::|..:.||||..|:.
Human   927 YTFVGPVLAIIGVNGLVLAMAMLKLLRPSLSEGPPAEKRQALLGVIKALLILTPIFGLTWGLGLA 991

  Fly   728 AFM-QAGVAFSYLFCITATMQGFVMFIYFVLLDSTNRRLWVGLICPTKMELDVQKRTTELQSMTT 791
            ..: :......|:|.|..|:||..:.::..|:|             .|::..::||....|:  .
Human   992 TLLEEVSTVPHYIFTILNTLQGVFILLFGCLMD-------------RKIQEALRKRFCRAQA--P 1041

  Fly   792 SST 794
            |||
Human  1042 SST 1044

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 11/43 (26%)
7tm_4 500..750 CDD:304433 61/260 (23%)
ADGRF3NP_001138640.1 HRM 431..477 CDD:280888
GPS 713..758 CDD:280071 12/47 (26%)
7tm_4 770..1016 CDD:304433 61/260 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.