DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11318 and adgre14

DIOPT Version :9

Sequence 1:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:XP_021330419.1 Gene:adgre14 / 108182849 ZFINID:ZDB-GENE-131120-49 Length:505 Species:Danio rerio


Alignment Length:398 Identity:99/398 - (24%)
Similarity:178/398 - (44%) Gaps:72/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 SKVISISIPGLRSNYLSLPLPFLLRNENLRNPDSKAFSIGSGCGYWNYETWSTEGVSTESSSDLL 459
            |.|||:::|...:..||.|:.|..|:....:| |.:||    |.|||...|..:|.|..:::   
Zfish   130 SSVISVTLPKTTNTALSKPVNFTFRHIREFDP-SGSFS----CVYWNISKWIVDGCSVLNTN--- 186

  Fly   460 KDAIIECHTNHLTQFAFLVGGSYRANDLGEEILITPINEKVLDIISIVGCSLSLLGILGIFLTAA 524
             .:...|...||:.||.::  ..|::        .|.::.:|:::::| |  .::|:|  |.:.|
Zfish   187 -RSFTVCSCVHLSTFALIM--QTRSH--------PPESDSLLNVLNVV-C--VIVGLL--FFSLA 235

  Fly   525 LFKSWRSQASTKV----LLHLCLAMCLQMMLFV----FLNTDDVSEALVVNGNTVRCVALGAAMQ 581
            |....|.|.|..|    .:::|:::.|..:||:    ||:        ::....|.|:.:...:.
Zfish   236 LLTFTRCQWSPGVNNVARINICISLLLAHLLFLLTQQFLS--------LIRRQKVLCMLISGLLH 292

  Fly   582 YSILVLFSWMLIIAFLQFQRYVTVIGIERPPRYILK---AAIVAWLLPLVPTLLVALIDPDSYVP 643
            :..|..|.||.|.|.|.|.....:..|....:.:|:   ..::.:.:.||...:.|.:.|:.|..
Zfish   293 FLFLSGFVWMFIEAVLLFICVKNLSQISSQMKNVLRNKLLCVIGYAVALVVVSISAAVVPNGYGS 357

  Fly   644 SAAQLSTDTGICYPSGYGLIFGVVLPVTLITVCNLVIFVYVFYSISHSLSQSIHK--------NE 700
            ....:....        |.|:..:.|||:|...|:::|:    ||..||..:..|        |:
Zfish   358 EKCWIQMHK--------GFIWSFLGPVTIIIALNVILFI----SIGFSLKSAFKKLNADVSQLNQ 410

  Fly   701 KKMVVKQIRLSIMLFFLLGLTWIFGIFAFMQAGVAFSYLFCITATMQG-FVMFIYFVL---LDST 761
            .|:|:.:   ::..|.:||.:||.|.|.  .:......||.|..:.|| |:..||.||   :...
Zfish   411 TKIVMFK---TLAQFVVLGCSWILGFFT--NSSKVLEILFLILNSQQGTFIFLIYCVLNKGIRQE 470

  Fly   762 NRRLWVGL 769
            .|:|:..|
Zfish   471 YRKLFTSL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 10/37 (27%)
7tm_4 500..750 CDD:304433 63/269 (23%)
adgre14XP_021330419.1 GPS 167..205 CDD:197639 12/43 (28%)
7tm_GPCRs 214..476 CDD:333717 70/291 (24%)
TM helix 1 217..241 CDD:320095 8/28 (29%)
TM helix 2 250..271 CDD:320095 4/20 (20%)
TM helix 3 285..307 CDD:320095 5/21 (24%)
TM helix 4 331..347 CDD:320095 2/15 (13%)
TM helix 5 365..388 CDD:320095 7/30 (23%)
TM helix 6 412..435 CDD:320095 8/25 (32%)
TM helix 7 439..464 CDD:320095 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4884
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.