DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15553 and MEE15

DIOPT Version :9

Sequence 1:NP_651841.3 Gene:CG15553 / 43677 FlyBaseID:FBgn0039817 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001323497.1 Gene:MEE15 / 816200 AraportID:AT2G16970 Length:460 Species:Arabidopsis thaliana


Alignment Length:530 Identity:110/530 - (20%)
Similarity:191/530 - (36%) Gaps:125/530 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LEWGRLFNMFYIEPVLFMLIFSHMLSGTVMRNQLIYQACTVIFQYNETDCKLLDSKNTTTEIQAI 76
            :|..||..:.::...:|:..||..|...||.:..:...|:.:   ||| |.|   ....|.::.:
plant     1 MEEYRLGELRHLLTTVFLSGFSEFLVKPVMTDVTVAAVCSGL---NET-CSL---AVYLTGVEQV 58

  Fly    77 ETELQDYVANMFLTRTLFESIMPAICGLFVGSWSDQYGRKPLMIVSLVGFSASALISSIICWLSS 141
            ...|...|            :||.|     |:.||:||.|.|:.:.:             |    
plant    59 TVGLGTMV------------MMPVI-----GNLSDRYGIKTLLTLPM-------------C---- 89

  Fly   142 YYMVNPWWYTLAAVPHSVL------GGWCVFSVAAFCF---ITDTTDMKTRPY---------RMI 188
                      |:.:|.::|      ..:..|.:....|   ...|.|.....|         |:.
plant    90 ----------LSILPPAILAYRRDTNFFYAFYITKILFDMVCQGTVDCLAHAYVAKNVCGRKRIS 144

  Fly   189 FMEIILFVALTSGSLLSSFVYAATSSAFVQSLSCLIVIIATLFII------FYLPESLGMSPEED 247
            ...::..|...||       ..||.||.:..::.:..:.|..|..      .:|.|.| ...:||
plant   145 MFGVLAGVRSISG-------VCATFSARLLPIASIFQVAAISFFFGLVYMRVFLKERL-HDDDED 201

  Fly   248 EIPEKEKNVVVTVLDHKNKTNEISAEAEKTENCDDPPKYESPEK---PLEDKVEKAGLFSIKHVK 309
            :..|.:.    |...:.:...:::..||       |...::|.|   .|..|...        :|
plant   202 DCDEDDN----TSGRNHHDGGDLTMLAE-------PILRDAPTKIHIVLNTKYSS--------LK 247

  Fly   310 DMFSTCFKKRENNAHTIIWLVTLAGFVSIFVADGVMTVNYLFVRQQFHFTVRDFTIFETFSQSVP 374
            ||.|..    :|:  ||:....:..|.:.|...|:.:....|::.:|.|...||.   .....|.
plant   248 DMVSLI----KNS--TILVQTLVVTFFATFAQSGMQSAFLYFLKARFGFNKNDFA---ELILLVT 303

  Fly   375 MLGAVLGILILRKFFGLSVVALALLS--LLSEVAANIARGFAYLSWHLYLSVVLGIFRSIQGPMF 437
            ::|::..:.||.|... ::....:||  ||.:.........::.:|..|.:.||........|..
plant   304 IIGSISQLFILPKLVS-AIGERRVLSTGLLMDSVNAACLSVSWSAWVPYATTVLVPVTMFVMPSV 367

  Fly   438 RTIVSNIVPPSDTGKLFAIGNILQSF----APFVAAPLYTAIYKESLASNPGGFNFLSAAFYGLA 498
            ..|.|..|.|.:.||:....:.::||    |||:.:||......|.......||:.|...|    
plant   368 CGIASRQVGPGEQGKVQGCISGVKSFSGVVAPFIYSPLTALFLSEKAPFYFPGFSLLCVTF---- 428

  Fly   499 FILIGWVMRI 508
            .::||:.:.:
plant   429 SLMIGFFLSL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15553NP_651841.3 MFS_1 96..469 CDD:284993 83/405 (20%)
MFS 97..239 CDD:304372 30/165 (18%)
MEE15NP_001323497.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.